PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915986.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Nin-like
Protein Properties Length: 961aa    MW: 105530 Da    PI: 6.238
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915986.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.71.1e-28586637152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCR++GI+RWP+Rki+++
  XP_010915986.1 586 AEKTISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRHHGISRWPSRKINKV 637
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.54576657IPR003035RWP-RK domain
PfamPF020421.1E-25589637IPR003035RWP-RK domain
SuperFamilySSF542774.58E-20865951No hitNo description
PROSITE profilePS5174518.261866948IPR000270PB1 domain
SMARTSM006665.2E-23866948IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.9E-24866947No hitNo description
PfamPF005644.3E-15866947IPR000270PB1 domain
CDDcd064071.06E-32867947No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MSAAGDGDEG KGPFAARREL MDLDLDPASW PFDPIALITG PPSPSFLASS SPQSLLQFPF  60
LSPPSPLWLF EDRGFDASNS LPRFVSCNSD ATNGNISSGA NDNTRQRQLS SEEENSNGSC  120
MFKERMSQAL RYLKDSTNQH LLVQVWAPVK NGNRYVLTTS EQPFVLDPRS VGLLHYRTVS  180
VTYRFSVDGD QDGDLGLPGR VFRQKVPEWT PDVQYYSTKE YPRLSHALHD NVRGTLALPV  240
FEPCDQSCIG VVELIMTSPK INYAGEVDKV CKALKAVNLK SSEILNHPNV QICNEGRQAA  300
LAEILKILTM VCEAYKLPLA QTWVPCRHRS ILAHGGGLKK NCSSFDGTCM GQVCMSTTDV  360
AFHVIDAHMW GFREACVEHH LQKGQGVAGR AFASRRPCFS KDITQFSKIE YPLVHYARMF  420
GLACCFALCL QSTQTGHDDY VLEFFLPPDC EDAGEQLALL QSMTTMMEKC FCSLKVITDV  480
ELQEGSSLEV IDMLEIGSQK SEPKPIYMRC CENGLHTFPE CNLVEGLNGM QKEKNAIPEL  540
SEQHFLTDSN DGKNTKIVVD SSGTGTPCSS LVNKKNRPLE RRRGKAEKTI SLEVLQQYFA  600
GSLKDAAKSL GVCPTTMKRI CRHHGISRWP SRKINKVNRS LSKLKGVIES VHGSGGFDLT  660
SLTGPLPVAV GSISWPIKLD NSKQSEGAKV LDPHGKRDKG SLMHKSVEDE EQCKMFIAQQ  720
DSVRDCDIQL GPGKPSYSSK SGSSSGEGSM NPPTSEGSCQ GSPMNETHMG KPFASSILQI  780
GENISDPLGF PEQTAQDLNR LAVCSISDAI AVEPQPPLDG ILIKDPGNSN DLKDLCTSTM  840
HDCHDDNALG PTSDPAKPMS IQDLRTVTIK ASYKEDIIRF RMRCTAGIIP LRNEIAKRLK  900
LEIGTFDIKY LDDDHEWVML ACYADLQECM EISRLSGGRV IRLSVNDILP SPGSSCESSG  960
G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915986.10.0PREDICTED: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK7VRG40.0K7VRG4_MAIZE; Uncharacterized protein
STRINGGRMZM2G375675_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7